15-Min Penne Alla Vodka
Creamy tomato pasta made with marinara, cream, and parmesan—ready in under 5 minutes. No vodka required; the sauce is silky and satisfying as-is.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g
comfortquickitalianvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz penne
- 1 cup marinara sauce
- ½ cup heavy cream
- ½ cup parmesan cheese, grated
Instructions
- 1
Boil penne in salted water until al dente, about 9 minutes.
- 2
Pour marinara and cream into a large skillet over medium heat.
- 3
Stir constantly until the sauce is smooth and just beginning to bubble, ~2 minutes.
- 4
Drain pasta, reserving 1/4 cup pasta water, then add to the skillet.
- 5
Toss gently until coated; add pasta water if needed to loosen the sauce.
- 6
Remove from heat, stir in parmesan, and serve immediately.
Tools you’ll need
- large pot for pasta water
- large skillet or sauté pan
- wooden spoon or silicone spatula
- colander
- measuring cups
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
