CookSnap is coming soon — Join the waitlist →

20-Min Pempek: Crispy Fish Cakes in Tangy Broth

Indonesian street-food classic simplified for weeknights: crispy golden fish-and-tapioca cakes simmered in a punchy garlic-vinegar broth. Chewy, savory, addictive.

Total time
20 min
Servings
2
Calories
420
Protein
28g
20-Min Pempek: Crispy Fish Cakes in Tangy Broth
comfortcasualindonesianfishcrispychewyweeknightmain-dish

Ingredients

  • 200 g white fish fillets (cod, snapper, or whiting), flaked
  • ¾ cup tapioca starch (or cornstarch)
  • 1 whole eggs
  • 100 g shrimp, chopped
  • 3 tbsp white vinegar
  • 4 whole garlic cloves, minced
  • ½ tsp chili flakes (or 1 red chili, sliced)

Instructions

  1. 1

    Mix flaked fish, tapioca starch, egg, and chopped shrimp in a bowl until sticky. Roll into 8 golf-ball-sized cakes.

  2. 2

    Heat 1/4 cup oil in a large skillet over medium-high until shimmering. Pan-fry fish cakes 2–3 minutes per side until golden.

  3. 3

    Pour out all but 1 tbsp oil. Add minced garlic and fry 30 seconds until fragrant.

  4. 4

    Add 1 cup water, vinegar, and chili flakes. Bring to a gentle simmer.

  5. 5

    Return fish cakes to the broth and simmer 2 minutes until heated through. Taste and adjust salt and vinegar.

  6. 6

    Serve hot in bowls with broth spooned over top. Accompany with crackers or rice if desired.

Tools you’ll need

  • mixing bowl
  • large skillet (12-inch preferred)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.