CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Pork Er Kuai Rice Cakes

Chewy pan-fried rice cakes topped with crispy pork, scallions, and a savory-spicy soy glaze. A TikTok-friendly take on the Yunnan street-food classic that hits in 20 minutes flat.

Total time
20 min
Servings
2
Calories
385
Protein
16g
Crispy Pork Er Kuai Rice Cakes
casualquickchineseporkcrispychewyweeknightmain-dish

Ingredients

  • 6 oz ground pork
  • 10 oz er kuai rice cakes (or fresh rice cake slices)
  • 3 tbsp soy sauce
  • 1.5 tbsp chili oil or hot sauce
  • 3 count scallions (white and green parts), sliced
  • 2 tbsp neutral cooking oil
  • 1 tbsp fresh ginger (minced)

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. 2

    Add ground pork and cook, breaking up with a spoon, until no pink remains, about 5 minutes.

  3. 3

    Stir in ginger and white scallion parts; cook for 30 seconds until fragrant.

  4. 4

    Push pork to the side. Add remaining 1 tbsp oil to the cleared space and lay rice cakes flat.

  5. 5

    Cook rice cakes 2–3 minutes per side without stirring until edges turn golden and crispy.

  6. 6

    Pour soy sauce and chili oil over everything; toss gently for 30 seconds until coated.

  7. 7

    Plate immediately. Top with green scallion parts and serve hot.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.