CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fish Pempek with Spicy Vinegar Sauce

Indonesian fried fish cakes with tapioca shell and tangy spiced vinegar dip. Ready in 25 minutes with crispy edges and a tender, savory center.

Total time
25 min
Servings
2
Calories
520
Protein
24g
Crispy Fish Pempek with Spicy Vinegar Sauce
casualsatisfyingindonesianfishcrispytenderchewyweeknight

Ingredients

  • 250 g cod or halibut fillet, skinless
  • ½ cup tapioca flour (or tapioca starch)
  • 2 tbsp all-purpose flour
  • 1.5 tbsp fish sauce
  • ¼ cup white vinegar
  • 1 tbsp red chili paste or sambal (optional but recommended)
  • ¼ tsp shrimp paste (terasi), optional
  • 1 cup neutral cooking oil for frying

Instructions

  1. 1

    Pulse fish in a food processor until finely ground, ~30 seconds. Transfer to a bowl.

  2. 2

    Mix tapioca flour, all-purpose flour, fish sauce, and 0.25 cup water into the ground fish until a paste forms.

  3. 3

    Heat oil in a deep skillet over medium-high until it shimmers, ~90 seconds.

  4. 4

    Scoop tablespoon-sized portions of paste and drop into hot oil. Fry until golden brown and crispy, ~4 minutes per batch.

  5. 5

    Whisk vinegar, chili paste, shrimp paste if using, 0.25 cup water, and a pinch of salt until smooth.

  6. 6

    Drain pempek on paper towels. Serve immediately with spiced vinegar sauce for dipping.

Tools you’ll need

  • food processor
  • bowl
  • deep skillet or sauce pot (3-quart minimum)
  • slotted spoon or spider strainer
  • paper towels
  • small bowl or serving cup for sauce

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.