CookSnap is coming soon — Join the waitlist →
Back to recipes

Batagor: Crispy Fish Dumplings with Peanut Sauce

Crispy pan-fried fish and shrimp dumplings served with a tangy-spicy peanut sauce. A beloved Indonesian street food that's simpler than it looks—frozen dumpling wrappers save time while the filling stays tender and flavorful.

Total time
25 min
Servings
4
Calories
310
Protein
12g
Batagor: Crispy Fish Dumplings with Peanut Sauce
casualsatisfyingindonesianfishshrimpcrispytenderweeknight

Ingredients

  • 20 wrappers frozen dumpling wrappers (round, wheat-based)
  • 200 g ground fish fillet (white fish) or shrimp, finely minced
  • 2 cloves garlic, minced
  • ¼ cup creamy peanut butter
  • 2 tbsp rice vinegar
  • 1 tbsp chili paste (sambal oelek) or sriracha
  • 3 tbsp vegetable oil

Instructions

  1. 1

    Mix minced fish and garlic in a small bowl with a pinch of salt.

  2. 2

    Place 1 tsp filling in center of each wrapper. Wet edges with water, fold in half, then bring corners together and press to seal.

  3. 3

    Whisk peanut butter, vinegar, chili paste, and 3 tbsp warm water until smooth. Add salt to taste.

  4. 4

    Heat oil in a large skillet over medium-high until shimmering, about 60 seconds.

  5. 5

    Pan-fry dumplings in batches without crowding, 2 minutes per side until golden and edges curl.

  6. 6

    Transfer fried dumplings to a serving plate. Drizzle with peanut sauce or serve sauce on the side.

Tools you’ll need

  • small mixing bowl
  • whisk
  • large skillet (12-inch)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.