CookSnap is coming soon — Join the waitlist →
Back to recipes

Batagor: Pan-Fried Fish Dumpling Appetizer

Crispy fried fish and shrimp dumplings with a tangy peanut-based dipping sauce. A beloved Indonesian street food that's simple to assemble and deeply satisfying.

Total time
45 min
Servings
4
Calories
320
Protein
14g
Batagor: Pan-Fried Fish Dumpling Appetizer
casualsatisfyingindonesianfishshrimpcrispytenderweeknight

Ingredients

  • ¾ lb ground fish (white fish fillet) or shrimp, finely chopped
  • 24 count wonton wrappers
  • 2 count garlic cloves, minced
  • 1 tbsp fresh ginger, minced
  • 2 cups vegetable oil for frying
  • ⅓ cup peanut butter, smooth or chunky
  • 2 tbsp soy sauce
  • 2 tbsp lime juice
  • ¼ cup hot water
  • 1 count fresh red chili (1, sliced) or chili flakes, plus green onions for garnish

Instructions

  1. 1

    Mix ground fish, garlic, and ginger with a pinch of salt until just combined.

  2. 2

    Place 1 tsp filling in the center of each wonton wrapper. Wet edges with water, fold in half, then bring corners together to seal.

  3. 3

    Whisk peanut butter, soy sauce, lime juice, and hot water until smooth and pourable. Stir in sliced chili or chili flakes.

  4. 4

    Heat oil in a deep skillet or wok to 350°F (175°C). If no thermometer, drop a small piece of wrapper in—it should sizzle immediately.

  5. 5

    Fry dumplings in batches, 2–3 minutes per side, until golden brown and crispy. Don't crowd the pan.

  6. 6

    Transfer to a paper towel-lined plate to drain. Sprinkle with salt while still hot.

  7. 7

    Arrange batagor on a plate. Drizzle or serve peanut sauce on the side. Garnish with sliced green onions.

Tools you’ll need

  • cutting board and knife
  • small bowl for mixing filling
  • small whisk or fork for sauce
  • deep skillet or wok (3-quart minimum)
  • deep-fry thermometer (optional but recommended)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.