CookSnap is coming soon — Join the waitlist →

Pani Puri

Crispy hollow shells filled with spiced potatoes, chickpeas, and tangy tamarind water—a beloved Indian street snack. Assemble at the table for maximum crunch and flavor.

Total time
25 min
Servings
2
Calories
185
Protein
6g
Pani Puri
casualfreshindianvegetarianchickpeascrispycreamysnack

Ingredients

  • 12 shells pani puri shells (gol gappas)
  • 1 cup boiled potato, peeled and diced into 1/4-inch cubes
  • ½ cup cooked chickpeas, drained
  • 1 cup tamarind paste mixed with water
  • ½ medium onion white onion, minced into 1/8-inch pieces
  • 1.5 teaspoons chaat masala seasoning
  • 3 tablespoons fresh cilantro, chopped into 1/4-inch pieces

Instructions

  1. 1

    Place the boiled potato on a cutting board and cut it into 1/4-inch cubes by slicing lengthwise, rotating 90 degrees, then slicing again crosswise into small, uniform pieces.

  2. 2

    Hold the onion root-side down on the cutting board and make three lengthwise cuts from the tip toward the root, spacing them 1/8 inch apart, then rotate and slice crosswise into minced pieces the size of a pea.

  3. 3

    Stir the tamarind paste into the water with a spoon until it dissolves completely and looks like weak tea—no lumps remain—about 1 minute.

  4. 4

    In a small bowl, toss the diced potato, chickpeas, minced onion, chaat masala, and cilantro with your fingertips until the seasoning is evenly distributed throughout.

  5. 5

    Using your index finger, gently punch a small hole in the top of each pani puri shell, enlarging it to roughly the width of a pencil eraser.

  6. 6

    Using a small spoon, fill each shell with approximately 1 tablespoon of the potato-chickpea mixture, packing it gently so it reaches the bottom without crushing the shell.

  7. 7

    Arrange filled shells on a plate, then pour 2 to 3 tablespoons of tamarind water over them just before eating so the shells stay crispy until the last moment.

Tools you’ll need

  • cutting board
  • chef's knife
  • small bowl
  • spoon
  • small spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.