CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Pancit Bihon

Stir-fried rice noodles with shrimp, chicken, and veggies in a light soy-garlic glaze. A Filipino weeknight classic that's crispy, savory, and ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
28g
20-Min Pancit Bihon
casualsatisfyingfilipinoshrimpchickentendercrispyweeknight

Ingredients

  • 8 oz rice noodles (bihon), 8 oz
  • ½ lb large shrimp, peeled and deveined
  • 1.5 cups rotisserie chicken, shredded
  • 2 medium carrots, julienned
  • 3 cups cabbage, sliced thin
  • 3 tbsp soy sauce
  • 4 cloves garlic, minced
  • 3 tbsp neutral oil

Instructions

  1. 1

    Soak rice noodles in hot water for 5 minutes until softened, then drain well.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add shrimp and cook, stirring, until pink, about 3 minutes. Push to the side.

  4. 4

    Add garlic to the cleared space, stir for 30 seconds until fragrant.

  5. 5

    Toss in carrots and cabbage, stir-fry 2 minutes until vegetables soften slightly.

  6. 6

    Add noodles, shredded chicken, and soy sauce. Toss everything for 1 minute until heated through and coated.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Filipino recipes →