CookSnap is coming soon — Join the waitlist →
Back to recipes

Pan-Seared Kielbasa with Caramelized Onions

Sliced kielbasa crisps in a hot skillet while onions soften and turn golden. Serve with mustard and crusty bread for an authentic Polish-inspired weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Pan-Seared Kielbasa with Caramelized Onions
comfortcasualpolishporkcrispytenderweeknightmain-dish

Ingredients

  • 1.5 lb kielbasa sausage
  • 2 medium yellow onions
  • 2 tbsp olive oil
  • ½ tsp salt
  • ¼ tsp black pepper
  • 3 tbsp whole-grain mustard

Instructions

  1. 1

    Slice kielbasa into 0.5-inch thick rounds. Cut onions in half, then slice into 0.25-inch-wide wedges.

  2. 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add kielbasa rounds in a single layer. Sear 3 minutes until edges crisp and edges darken, then flip and cook another 2 minutes.

  4. 4

    Transfer kielbasa to a plate. Keep heat at medium, add onions and salt to the skillet.

  5. 5

    Cook onions, stirring occasionally, until soft and golden brown, about 8 minutes. You'll smell sweet caramel notes.

  6. 6

    Return kielbasa to the skillet, toss with onions, and cook 1 minute until heated through. Taste and adjust seasoning.

  7. 7

    Divide kielbasa and onions among plates. Serve with a dollop of whole-grain mustard on the side.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Polish recipes →