CookSnap is coming soon — Join the waitlist →

15-Min Nasi Kandar Rice Bowl

A vibrant Malaysian curry rice bowl layered with fragrant yellow rice, spiced ground beef and shrimp, and topped with crispy fried onions. Cooked entirely in one skillet in under 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
15-Min Nasi Kandar Rice Bowl
satisfyingboldmalaysianbeefshrimptendercrispyweeknight

Ingredients

  • 2 cups cooked jasmine rice (cooled)
  • 1 tsp turmeric powder
  • ¼ lb ground beef
  • ¼ lb shrimp (peeled, deveined)
  • 2 tbsp red curry paste or sambal oelek
  • ½ cup coconut milk
  • ⅓ cup crispy fried onions
  • ¼ cup fresh cilantro (chopped)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high. Toss rice with turmeric until yellow, ~2 minutes.

  2. 2

    Push rice to the side. Add ground beef to the empty space, break into small pieces, cook until no pink, ~4 minutes.

  3. 3

    Add shrimp to the beef, stir-fry until pink and cooked through, ~2 minutes.

  4. 4

    Stir in curry paste until the meat and shrimp are coated, about 30 seconds.

  5. 5

    Pour in coconut milk, gently fold everything together until rice is warm and curry coats all, ~1 minute.

  6. 6

    Divide into bowls, top with crispy onions and cilantro. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.