CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Nasi Campur Bali

A vibrant one-pan Indonesian rice bowl topped with crispy eggs, shrimp, and chicken in a savory-sweet soy glaze. Ready in under 30 minutes with minimal dishes.

Total time
25 min
Servings
2
Calories
485
Protein
34g
Nasi Campur Bali
satisfyingfreshindonesianchickenshrimpcrispytenderfluffy

Ingredients

  • 2 cups cooked rice (day-old or cooled)
  • 6 oz chicken breast, boneless and skinless
  • 6 oz shrimp, peeled and deveined
  • 3 tablespoons soy sauce
  • 2 cloves garlic, minced
  • 2 whole eggs

Instructions

  1. 1

    Pat the chicken breast dry with paper towels, then place it on a cutting board and slice it lengthwise (parallel to the longer edge) into strips about 1/4-inch thick, like cutting a deck of cards.

  2. 2

    Mince the garlic until the pieces are smaller than a grain of rice — each piece should be about the size of a pencil-tip dot.

  3. 3

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  4. 4

    Add the chicken strips to the hot oil in a single layer and cook without stirring for 3 minutes until the undersides turn golden and the color climbs halfway up each piece.

  5. 5

    Flip each chicken piece and cook for another 2 minutes until the second side is golden and the thickest piece feels firm (not squishy) when pressed with a fork.

  6. 6

    Push the chicken to the side of the skillet, then add the shrimp to the empty space and cook for 1 minute until they just turn from gray to pink.

  7. 7

    Flip the shrimp and cook for 1 more minute until both sides are pink and the bodies curl into a tight C-shape.

  8. 8

    Scatter the minced garlic over the meat and stir everything for 20 seconds until the garlic becomes fragrant (you'll smell a sharp, peppery aroma).

  9. 9

    Pour in 3 tablespoons of soy sauce and stir constantly for 30 seconds until the soy coats all the meat and the pan smells deep and umami-rich.

  10. 10

    Add the 2 cups of cooked rice to the pan and break up any clumps with a wooden spoon, stirring constantly for 2 minutes until the rice is hot and evenly coated with the soy mixture.

  11. 11

    Transfer the rice mixture to two bowls and push to the side to make a small nest in the center of each bowl.

  12. 12

    Return the skillet to medium heat and add 1 tablespoon of oil to any remaining space, then crack both eggs into the pan and cover with a lid or foil.

  13. 13

    Cook the eggs covered until the whites turn completely opaque and the yolks still jiggle slightly when you shake the pan, about 3 minutes.

  14. 14

    Slide one fried egg onto the nest in the center of each rice bowl, keeping the yolk whole and centered.

Tools you’ll need

  • 12-inch skillet with lid or foil cover
  • cutting board
  • chef's knife
  • wooden spoon
  • paper towels
  • fork
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.