CookSnap is coming soon — Join the waitlist →

Mediterranean Flatbread with Tomatoes and Herbs

Crispy flatbread topped with fresh tomatoes, olives, feta, and aromatic herbs baked until golden. Ready in under 20 minutes for a light, satisfying meal.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Mediterranean Flatbread with Tomatoes and Herbs
lightfreshsimplemediterraneanvegetariancheesecrispytender

Ingredients

  • 2 pieces naan or pita flatbread
  • 1 cup cherry tomatoes
  • ½ cup kalamata olives, pitted
  • ¾ cup crumbled feta cheese
  • 2 tablespoons fresh oregano or basil, chopped
  • 2 tablespoons olive oil

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Halve the cherry tomatoes by slicing each one from top to bottom through the stem, creating two equal pieces.

  3. 3

    Chop the fresh oregano or basil into pieces smaller than a grain of rice, until you have 2 tablespoons.

  4. 4

    Place the two flatbreads on a large baking sheet, leaving 2 inches of space between them.

  5. 5

    Drizzle 1 tablespoon of olive oil evenly across the surface of both flatbreads, using about half the oil total.

  6. 6

    Scatter the halved cherry tomatoes, kalamata olives, and crumbled feta cheese evenly across the top of both flatbreads.

  7. 7

    Sprinkle the chopped oregano or basil evenly across the top, dividing it between both flatbreads.

  8. 8

    Drizzle the remaining 1 tablespoon of olive oil in a light stream across the top of the toppings.

  9. 9

    Slide the baking sheet into the preheated oven and bake for 8 minutes, until the edges of the flatbread turn the color of light golden toast.

  10. 10

    Remove the baking sheet from the oven using oven mitts and let the flatbreads rest for 1 minute before serving.

Tools you’ll need

  • oven
  • large baking sheet
  • cutting board
  • chef's knife
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.