CookSnap is coming soon — Join the waitlist →

Malaysian Roti Canai

Crispy, flaky Indian-influenced flatbread that's a Malaysian breakfast staple. Served with warm curry sauce for dipping, it's impressive to make at home and takes just 40 minutes.

Total time
40 min
Servings
2
Calories
420
Protein
8g
Malaysian Roti Canai
comfortelegantmalaysianvegetarianvegetariancrispyflakytender

Ingredients

  • 2 cups all-purpose flour
  • ½ tsp salt
  • ¾ cup warm water
  • 3 tbsp vegetable oil
  • 2 tbsp curry powder
  • ½ medium onion, finely minced
  • 1 cup coconut milk
  • ½ cup water

Instructions

  1. 1

    Whisk flour and salt together in a large bowl.

  2. 2

    Add warm water gradually, mixing with your hands until a shaggy dough forms.

  3. 3

    Knead for 2 minutes until dough is smooth and elastic. Cover and rest 20 minutes.

  4. 4

    Heat 1 tbsp oil in a saucepan over medium. Add minced onion and cook until soft, ~3 minutes.

  5. 5

    Stir in curry powder until fragrant, 30 seconds.

  6. 6

    Pour in coconut milk and water. Simmer 5 minutes stirring occasionally. Keep warm.

  7. 7

    Divide dough into 4 balls. Oil your hands lightly and stretch one ball into a thin 8-inch round.

  8. 8

    Heat a 10-inch skillet over medium-high until shimmering, ~90 seconds.

  9. 9

    Lay roti in skillet. Cook until bottom is golden brown with crispy edges, ~2 minutes.

  10. 10

    Flip and cook the other side until golden, ~1.5 minutes. Transfer to a plate.

  11. 11

    Repeat with remaining 3 dough balls, adding a bit more oil to the pan as needed.

  12. 12

    Serve roti hot with warm curry sauce for dipping.

Tools you’ll need

  • large mixing bowl
  • whisk
  • 10-inch non-stick or cast iron skillet
  • small saucepan
  • wooden spoon
  • paper towels
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.