CookSnap is coming soon — Join the waitlist →
Back to recipes

Lemon Rice with Peas & Peanuts

Vibrant South Indian lemon rice — fragrant, tangy, and studded with roasted peanuts and peas. Ready in 15 minutes with cooked rice and a squeeze of citrus.

Total time
15 min
Servings
2
Calories
385
Protein
11g
Lemon Rice with Peas & Peanuts
freshsimpleindianvegetariandairy-freepeanutsfluffycrunchy

Ingredients

  • 2 cups cooked rice (white or basmati)
  • 1 whole (juiced) lemon
  • ¼ cup roasted unsalted peanuts
  • ½ cup frozen peas
  • ½ tsp turmeric powder
  • 8 leaves curry leaves (or cilantro, chopped)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium heat until shimmering, about 1 minute.

  2. 2

    Add peanuts and toast 90 seconds until fragrant. Stir in turmeric and curry leaves, cook 30 seconds.

  3. 3

    Add frozen peas and stir for 1 minute until they begin to thaw and soften.

  4. 4

    Add cooked rice and break up any clumps with a spoon. Toss constantly for 2 minutes until heated through.

  5. 5

    Pour lemon juice over rice, season with salt and pepper to taste, toss well.

  6. 6

    Serve hot with fresh lemon wedges on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring cups
  • citrus juicer or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Indian recipes →