CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Minute Lemon Curd Tart with Torched Meringue

No-bake lemon curd in a buttery crust topped with silky meringue and a chocolate dome — torched golden and viral-ready. Looks restaurant-fancy, tastes bright and tangy.

Total time
25 min
Servings
6
Calories
420
Protein
4g
25-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

  • 1.5 cups graham cracker crumbs
  • 5 tbsp butter, melted
  • 1 cup lemon curd (store-bought or homemade)
  • ½ cup heavy cream
  • 3 large egg whites (room temperature)
  • 6 tbsp granulated sugar
  • 3 oz dark chocolate, chopped

Instructions

  1. 1

    Mix graham cracker crumbs with melted butter, press into a 9-inch tart pan, and refrigerate.

  2. 2

    Whip heavy cream to soft peaks, then fold into lemon curd until combined and mousse-like.

  3. 3

    Spread lemon curd mousse over the chilled crust, smooth the top, and chill while you make meringue.

  4. 4

    Beat egg whites with an electric mixer until soft peaks form, about 2 minutes.

  5. 5

    Gradually add sugar while beating until stiff, glossy peaks form and sugar dissolves, ~3 minutes.

  6. 6

    Spread meringue over the lemon curd, creating peaks and swirls with the back of a spoon.

  7. 7

    Melt chocolate in a heatproof bowl over hot water until glossy, then drizzle or pour over meringue.

  8. 8

    Use a kitchen torch to lightly brown the meringue peaks until golden. Serve chilled or at room temperature.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • electric mixer or whisk
  • heatproof bowl
  • kitchen torch
  • rubber spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →