CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Lemon Curd Tart with Torched Meringue

Shop-bought pastry shell filled with silky homemade lemon curd, topped with torched Italian meringue. Glossy, tart, and Instagram-ready in under 30 minutes.

Total time
28 min
Servings
8
Calories
385
Protein
4g
Crispy Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

  • 4 count large egg yolks
  • ½ cup lemon juice
  • ½ cup butter
  • ¾ cup sugar
  • 1 count pre-baked tart shell (9-inch)
  • 3 count large egg whites
  • ¼ cup powdered sugar
  • ¼ tsp cream of tartar

Instructions

  1. 1

    Fill a saucepan halfway with water and bring to a boil. Whisk egg yolks, lemon juice, butter, and sugar in a heatproof bowl.

  2. 2

    Set the bowl over simmering water (don't let it touch water). Whisk constantly until pale, glossy, and thick enough to coat a spoon, ~8 minutes.

  3. 3

    Pour curd through a fine sieve into a bowl. Let cool to room temperature, stirring occasionally, ~6 minutes.

  4. 4

    Spoon curd into the tart shell and spread level. Chill while you make the meringue.

  5. 5

    Whip egg whites and cream of tartar until foamy. Gradually add powdered sugar while beating until stiff, glossy peaks form, ~3 minutes.

  6. 6

    Spread or pipe meringue over the curd, creating peaks. Use a kitchen torch to brown the surface until golden and charred.

Tools you’ll need

  • saucepan
  • whisk
  • heatproof bowl
  • fine-mesh sieve
  • electric mixer or whisk
  • kitchen torch
  • 9-inch tart shell (pre-baked)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →