CookSnap is coming soon — Join the waitlist →
Back to recipes

Kimchi Pancake

Crispy-edged scallion pancake filled with tangy kimchi and melty cheese. Ready in 20 minutes—perfect for breakfast or a quick lunch.

Total time
20 min
Servings
2
Calories
380
Protein
11g
Kimchi Pancake
casualquickkoreanvegetarianvegetariancrispychewyweeknight

Ingredients

  • 1 cup kimchi, drained and chopped
  • 1 cup all-purpose flour
  • ¾ cup water
  • 3 whole scallions, chopped
  • ½ cup sharp cheddar or mozzarella, shredded
  • 3 tbsp neutral oil
  • 1 pinch salt and pepper

Instructions

  1. 1

    Whisk flour, water, salt, and pepper until smooth. Fold in kimchi and scallions.

  2. 2

    Heat 1.5 tbsp oil in a 10-inch skillet over medium-high until shimmering, ~1 minute.

  3. 3

    Pour half the batter into the pan. Sprinkle half the cheese on top. Cook 3–4 minutes until golden brown underneath.

  4. 4

    Flip carefully. Cook 2 minutes more until the second side crisps and cheese melts.

  5. 5

    Slide onto a cutting board. Repeat with remaining oil, batter, and cheese.

  6. 6

    Cut pancakes into wedges. Serve hot with soy sauce or sriracha for dipping.

Tools you’ll need

  • 10-inch nonstick or cast iron skillet
  • small mixing bowl
  • whisk
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.