CookSnap is coming soon — Join the waitlist →
Back to recipes

Beijing Jianbing Breakfast Crepe

Crispy-edged Chinese street crepe filled with egg, crumbled tempeh, and scallions, topped with hoisin and chili sauce. Ready in 20 minutes with just one pan.

Total time
20 min
Servings
2
Calories
385
Protein
14g
Beijing Jianbing Breakfast Crepe
casualquickchinesevegetarianeggstempehcrispycreamy

Ingredients

  • 1 cup all-purpose flour
  • 1 cup water
  • 2 whole eggs
  • 4 oz tempeh, crumbled
  • 2 whole scallions, chopped
  • 2 tbsp hoisin sauce
  • 1 tbsp chili oil or sriracha

Instructions

  1. 1

    Whisk flour and water until smooth, no lumps. Let rest 2 minutes.

  2. 2

    Crumble tempeh into ¼-inch pieces with your hands.

  3. 3

    Heat oil in a 12-inch nonstick skillet over medium-high until shimmering, ~90 seconds.

  4. 4

    Pour ½ cup batter into the center; tilt and swirl pan to spread into a thin 8-inch crepe.

  5. 5

    Cook until the bottom is light golden and edges curl, ~2 minutes, then flip.

  6. 6

    Push crepe to the edge of the pan. Crack 1 egg into the center and scramble lightly with a spatula.

  7. 7

    Scatter half the crumbled tempeh and scallions over the egg. Cook until the egg is set, ~1 minute.

  8. 8

    Drizzle hoisin and chili oil across the crepe. Fold in half and slide onto a plate.

  9. 9

    Repeat steps 4–8 with remaining batter, egg, tempeh, and scallions to make a second crepe.

Tools you’ll need

  • 12-inch nonstick skillet
  • whisk
  • small bowl
  • spatula
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.