CookSnap is coming soon — Join the waitlist →

Crispy Kimchi Pancake

A savory Korean breakfast staple with a crispy golden exterior and tender, umami-packed interior. Serve with soy dipping sauce for a quick morning or afternoon snack.

Total time
20 min
Servings
2
Calories
285
Protein
6g
Crispy Kimchi Pancake
casualquickkoreanvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1.5 cups kimchi, coarsely chopped
  • ¾ cup all-purpose flour
  • ½ cup water
  • 2 tbsp kimchi juice (from jar)
  • 3 whole scallions, chopped
  • 1 tbsp sesame seeds
  • ¼ tsp salt
  • 3 tbsp neutral oil for pan-frying

Instructions

  1. 1

    Whisk together flour, water, kimchi juice, and salt until smooth batter forms.

  2. 2

    Fold in chopped kimchi and scallions until evenly distributed throughout.

  3. 3

    Heat oil in a 10-inch skillet over medium-high heat until shimmering, ~90 seconds.

  4. 4

    Pour batter into skillet, flatten gently with spatula to even 1/4-inch thickness.

  5. 5

    Cook without moving until bottom is golden brown and crispy, 4-5 minutes.

  6. 6

    Slide onto a plate, then return to skillet to cook other side until golden, 3-4 minutes.

  7. 7

    Transfer to cutting board, sprinkle sesame seeds over top, cut into 6 wedges.

Tools you’ll need

  • 10-inch non-stick or cast iron skillet
  • mixing bowl
  • whisk
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.