CookSnap is coming soon — Join the waitlist →
Back to recipes

Kake Soba

A warm Japanese buckwheat noodle soup topped with a savory egg ribbon and green onions. Ready in 20 minutes with just six ingredients and one pot.

Total time
20 min
Servings
2
Calories
310
Protein
12g
Kake Soba
comfortlightjapanesevegetarianeggstendersilkyweeknight

Ingredients

  • 4 cups water
  • 3 tablespoons soy sauce
  • 1 tablespoon mirin (sweet rice wine)
  • 6 ounces dried soba noodles
  • 2 whole eggs
  • 2 whole green onions (scallions)

Instructions

  1. 1

    Slice the green onions crosswise into thin rings about 1/8 inch wide, keeping the white and green parts separate in two piles on the cutting board.

  2. 2

    Crack the 2 eggs into a small bowl and whisk them together with a fork until the yolks and whites are fully combined and uniform in color.

  3. 3

    Pour 4 cups of water into a large pot and bring it to a rolling boil over high heat, about 5 minutes — the water will bubble vigorously across the entire surface.

  4. 4

    Carefully add the 6 ounces of dried soba noodles to the boiling water and stir with a wooden spoon so they don't stick together, then return to a boil.

  5. 5

    Cook the noodles for 4 minutes until they are tender but still slightly firm when you bite one, stirring occasionally to prevent sticking.

  6. 6

    Stir in 3 tablespoons of soy sauce and 1 tablespoon of mirin, tasting a small spoonful to check if the broth tastes savory and slightly sweet.

  7. 7

    Slowly pour the beaten egg into the simmering broth while stirring gently in a circular motion so the egg forms thin ribbons throughout the soup, about 20 seconds.

  8. 8

    Remove the pot from heat and pour the noodles and broth into two deep bowls, dividing them equally.

  9. 9

    Scatter the white parts of the green onions over each bowl, then top with the green parts for a pop of color and mild onion flavor.

Tools you’ll need

  • large pot (3-quart or larger)
  • wooden spoon
  • small bowl
  • fork
  • cutting board
  • chef's knife
  • two deep soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.