CookSnap is coming soon — Join the waitlist →
Back to recipes

Japanese Udon Noodle Soup

Silky udon noodles in a rich dashi broth topped with tender chicken and shrimp. This classic Japanese comfort soup comes together in under 40 minutes with simple pantry staples.

Total time
35 min
Servings
4
Calories
385
Protein
32g
Japanese Udon Noodle Soup
comfortcozyjapanesechickenshrimptendersilkyweeknight

Ingredients

  • ¾ lb chicken thighs, boneless skinless
  • ½ lb large shrimp, peeled and deveined
  • 6 cups dashi stock
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • 1 lb fresh udon noodles
  • 3 stalks green onions, sliced
  • 1 sheet nori seaweed sheet, torn
  • 2 tbsp sesame seeds and shichimi togarashi (optional garnish)

Instructions

  1. 1

    Cut chicken thighs into 1-inch cubes. Pat shrimp dry with paper towels.

  2. 2

    Bring dashi to a boil in a large pot over medium-high heat, ~4 minutes.

  3. 3

    Add chicken cubes. Simmer until cooked through, no pink inside, ~8 minutes.

  4. 4

    Stir in soy sauce and mirin. Taste and adjust seasoning if needed.

  5. 5

    Add shrimp. Cook until pink and opaque throughout, ~3 minutes.

  6. 6

    Add fresh udon noodles. Simmer until heated through, ~2 minutes.

  7. 7

    Ladle soup into bowls. Top with green onions, torn nori, and sesame seeds.

  8. 8

    Serve immediately with optional shichimi togarashi on the side.

Tools you’ll need

  • large pot (6-quart minimum)
  • cutting board
  • chef's knife
  • wooden spoon
  • soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.