CookSnap is coming soon — Join the waitlist →

Quick Udon Noodle Soup

A warming Japanese noodle soup with tender udon, a savory broth, and mixed proteins ready in under 30 minutes. Perfect for a quick weeknight dinner.

Total time
25 min
Servings
2
Calories
380
Protein
32g
Quick Udon Noodle Soup
comfortcozyjapanesechickenshrimptendersilkyweeknight

Ingredients

  • 4 cups dashi stock (or chicken broth)
  • 3 tablespoons soy sauce
  • 1 tablespoon mirin (sweet rice wine)
  • 8 ounces fresh udon noodles
  • 6 ounces chicken thigh (or thighs), boneless and skinless
  • 4 ounces medium shrimp, peeled and deveined

Instructions

  1. 1

    Place the chicken thigh skin-side up on a cutting board and slice it lengthwise (from the widest point to the narrow point) into strips about 0.5 inches thick, following the natural grain.

  2. 2

    Pour the dashi stock into a large pot and place it over medium-high heat until you see small bubbles starting to rise from the bottom and sides, about 3 minutes.

  3. 3

    Add the chicken strips to the simmering broth and stir once, spreading them out so they don't clump together.

  4. 4

    Let the chicken cook without stirring for 4 minutes, until the surface is no longer pink and the thickest part is opaque white when you peek at it.

  5. 5

    Add the shrimp to the pot and stir gently to distribute them, then cook for 2 minutes until they turn from gray to bright pink and feel firm when you poke one.

  6. 6

    Pour in the soy sauce and mirin, then stir for 10 seconds until the broth looks glossy and smells savory.

  7. 7

    Add the fresh udon noodles to the pot, gently breaking apart any clumps with a wooden spoon as they soften, and simmer for 2 minutes.

  8. 8

    Taste the broth by sipping a small spoonful and add salt or soy sauce (a few drops at a time) if you want it more salty.

  9. 9

    Ladle the soup into two bowls, dividing the noodles, broth, chicken, and shrimp evenly between them.

Tools you’ll need

  • large pot (4–5 quarts)
  • cutting board
  • chef's knife
  • wooden spoon
  • ladle
  • soup bowls (2)
  • spoon for tasting

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.