CookSnap is coming soon — Join the waitlist →
Back to recipes

Umami Udon Noodle Soup with Chicken and Shrimp

Rich, deeply savory broth built from dashi and soy, topped with tender chicken, succulent shrimp, and chewy udon noodles. A showstopper weeknight meal that tastes like it simmered for hours.

Total time
45 min
Servings
4
Calories
385
Protein
38g
Umami Udon Noodle Soup with Chicken and Shrimp
comfortcozyjapanesechickenshrimptenderchewyweeknight

Ingredients

  • 2 tbsp dashi powder (kombu + bonito)
  • 4 tbsp soy sauce
  • 2 tbsp mirin (sweet rice wine)
  • 6 cups water
  • 12 oz chicken breast, boneless
  • 8 oz shrimp, peeled and deveined
  • 14 oz fresh udon noodles
  • 2 whole green onions, sliced thin
  • 4 oz shiitake mushrooms, caps sliced
  • 1 tbsp ginger, peeled and sliced thin
  • 1 whole garlic clove, minced
  • 1 tsp sesame oil

Instructions

  1. 1

    Slice chicken breast in half horizontally to create two thinner cutlets of even thickness.

  2. 2

    Slice mushroom caps into 1/4-inch-thick pieces. Slice green onions into thin rings, separating white and green parts.

  3. 3

    Pour water into a 4-quart pot. Stir in dashi powder, soy sauce, mirin, ginger slices, and minced garlic.

  4. 4

    Bring to a boil over medium-high heat, ~8 minutes. Once boiling, add mushroom slices and reduce heat to medium.

  5. 5

    Gently lay chicken cutlets into broth. Simmer without stirring for 7 minutes until chicken is firm to touch.

  6. 6

    Remove chicken cutlets to a cutting board. Let rest 2 minutes, then slice crosswise into 1/2-inch strips.

  7. 7

    Return broth to a gentle boil. Add shrimp and cook without stirring until they turn opaque pink, ~3 minutes.

  8. 8

    In a separate pot, bring salted water to a rolling boil. Add fresh udon noodles and stir gently to separate.

  9. 9

    Cook noodles for 2 minutes until just tender (fresh udon cooks fast), then drain in a colander.

  10. 10

    Divide noodles among four bowls. Ladle hot broth, shrimp, and mushrooms evenly over noodles.

  11. 11

    Top each bowl with sliced chicken, white parts of green onion, and a drizzle of sesame oil.

  12. 12

    Scatter green parts of green onion on top. Serve immediately.

Tools you’ll need

  • 4-quart pot
  • medium pot for noodles
  • cutting board
  • sharp knife
  • colander
  • soup ladle
  • four soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.