CookSnap is coming soon — Join the waitlist →
Back to recipes

Italian Pasta Salad with Chickpeas & Herbs

A vibrant cold pasta salad loaded with chickpeas, fresh vegetables, and a bright lemon-herb dressing. Perfect for meal prep, picnics, or a light dinner that tastes better the next day.

Total time
25 min
Servings
4
Calories
480
Protein
16g
Italian Pasta Salad with Chickpeas & Herbs
freshlightsimpleitalianmediterraneanvegetarianchickpeastender

Ingredients

  • 12 oz short pasta (penne, farfalle, or ditalini)
  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • 1.5 cups cherry tomatoes
  • 1 medium cucumber
  • 1 medium red bell pepper
  • ½ medium red onion
  • 1 cup fresh parsley and basil (chopped), divided
  • 2 whole lemon
  • 5 tbsp extra-virgin olive oil
  • ¾ cup shaved Parmesan cheese
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Halve the cherry tomatoes. Dice the cucumber into 1/2-inch chunks.

  2. 2

    Dice the bell pepper and red onion into 1/4-inch pieces.

  3. 3

    Juice both lemons into a small bowl. Whisk in 5 tbsp olive oil, salt, and pepper.

  4. 4

    Boil pasta in salted water until al dente, ~9 minutes. Drain and rinse with cold water.

  5. 5

    Transfer cooled pasta to a large bowl. Add chickpeas, tomatoes, cucumber, bell pepper, and red onion.

  6. 6

    Pour dressing over salad. Toss until everything is coated and evenly distributed.

  7. 7

    Fold in 3/4 cup fresh herbs. Top with shaved Parmesan and remaining herbs.

  8. 8

    Refrigerate at least 30 minutes before serving. Flavors deepen after 2+ hours.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • small bowl
  • whisk
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.