CookSnap is coming soon — Join the waitlist →
Back to recipes

Iskender Beef Skillet

Spiced ground beef over crispy bread cubes, finished with warm tomato and yogurt sauces. A TikTok-easy take on the Turkish classic — no oven, one skillet, weeknight ready.

Total time
15 min
Servings
2
Calories
485
Protein
28g
Iskender Beef Skillet
comfortsatisfyingturkishbeefcrispytenderweeknightmain-dish

Ingredients

  • ¾ lb ground beef
  • 2 pieces flatbread or pita
  • ½ cup Greek yogurt
  • ¾ cup canned crushed tomato
  • 1 tbsp tomato paste
  • ½ tsp each ground cumin and red pepper flakes

Instructions

  1. 1

    Tear flatbread into bite-sized pieces. Heat 2 tbsp oil in a large skillet over medium-high until shimmering.

  2. 2

    Add bread pieces and pan-fry, tossing occasionally, until golden and crispy on edges, about 4 minutes.

  3. 3

    Push bread to the side. Add ground beef to empty space and brown, breaking apart with a spoon, 4 minutes.

  4. 4

    Stir in cumin, red pepper flakes, tomato paste. Cook until fragrant, about 1 minute.

  5. 5

    Add crushed tomato and 2 tbsp water. Simmer 2 minutes, stirring gently to coat bread.

  6. 6

    Drizzle yogurt across the top. Finish with a pinch of salt and black pepper. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.