CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Iskender Kebab with Butter & Yogurt

Crispy-edged ground beef on pita, smothered in warm tomato sauce, melted butter, and cool yogurt. Grilled tomato on the side makes it complete.

Total time
20 min
Servings
2
Calories
520
Protein
28g
20-Min Iskender Kebab with Butter & Yogurt
comfortsatisfyingturkishbeefcrispycreamytenderweeknight

Ingredients

  • ¾ lb ground beef
  • 2 pieces pita bread
  • ½ cup Greek yogurt
  • ½ cup canned crushed tomato
  • 3 tbsp butter
  • 1 large tomato (for grilling)

Instructions

  1. 1

    Heat 1 tbsp butter in a skillet over medium-high. Brown ground beef, breaking it into small pieces, until no pink remains, about 6 minutes.

  2. 2

    Warm crushed tomato in a small pan, stirring occasionally, until it starts to bubble, about 3 minutes.

  3. 3

    Toast pita bread directly over a burner flame or in a dry skillet until warm and lightly charred, 1 minute per side.

  4. 4

    Slice tomato into thick rounds. Sear in the same skillet (oil or butter as needed) until soft and caramelized, 2 minutes per side.

  5. 5

    Place pita on a plate. Layer beef on top, then pour warm tomato sauce over it. Dollop yogurt on the side.

  6. 6

    Melt remaining 2 tbsp butter in a small pan, then drizzle over the yogurt and beef. Serve with grilled tomato.

Tools you’ll need

  • 12-inch skillet or larger
  • small saucepan
  • wooden spoon
  • kitchen tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.