Iced Hojicha Latte
Roasted Japanese tea brewed strong, chilled, and topped with creamy milk foam. Ready in 5 minutes—no stove required if you use hot water from a kettle.
- Total time
- 5 min
- Servings
- 2
- Calories
- 95
- Protein
- 3g
freshsimplejapanesevegetariancreamyweeknightcozybeverage
Ingredients
- 1.5 tbsp hojicha tea (loose or powder)
- 6 oz hot water
- 6 oz whole milk
- 1 tbsp honey or agave syrup
- 1 cup ice
Instructions
- 1
Steep hojicha in 6 oz hot water for 2 minutes, then strain into a pitcher.
- 2
Pour hojicha tea over ice into two glasses, filling each halfway.
- 3
Warm milk in a microwave-safe cup for 45 seconds until steaming.
- 4
Whisk or froth the warm milk for 30 seconds until foam rises to the top.
- 5
Drizzle honey into each glass, then pour frothed milk over the tea.
- 6
Top each glass with a spoonful of milk foam and serve immediately.
Tools you’ll need
- kettle or hot water source
- fine-mesh strainer or tea infuser
- pitcher
- two 12 oz glasses
- microwave-safe cup
- whisk or milk frother
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
