CookSnap is coming soon — Join the waitlist →
Back to recipes

Hoe Deopbap — Korean Sashimi Rice Bowl

Fresh sashimi-grade fish over warm rice with a gochujang-sesame drizzle, topped with crispy seaweed, cucumber, and a runny egg yolk. Builds in 15 minutes flat — no cooking the fish.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Hoe Deopbap — Korean Sashimi Rice Bowl
freshelegantkoreangluten-freefishtendercrispyweeknight

Ingredients

  • 8 oz sashimi-grade raw fish (tuna, salmon, or yellowtail), thinly sliced
  • 1.5 cups cooked sushi rice or short-grain white rice, warm
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp sesame oil
  • ½ piece cucumber, thinly sliced
  • 2 sheets nori (dried seaweed sheets), torn or cut into strips
  • 2 piece egg yolks (for serving)

Instructions

  1. 1

    Divide warm rice between two bowls, creating a shallow well in the center of each.

  2. 2

    Stir gochujang and sesame oil together in a small bowl until smooth and glossy.

  3. 3

    Arrange sliced fish in a loose pile on top of the rice in each bowl.

  4. 4

    Scatter cucumber slices and torn nori around the fish, then drizzle the gochujang sauce over top.

  5. 5

    Gently slide one raw egg yolk into the center of each bowl, on top of the fish.

  6. 6

    Serve immediately. Mix everything together as you eat, letting the yolk coat the rice and fish.

Tools you’ll need

  • two bowls
  • small mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.