CookSnap is coming soon — Join the waitlist →
Back to recipes

Hawaiian Saimin with Egg & Bok Choy

Silky ramen noodles in a light dashi-inspired broth, topped with a crispy fried egg and tender bok choy. A 15-minute weeknight dinner that tastes like island comfort.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Hawaiian Saimin with Egg & Bok Choy
comfortsimplehawaiianeggssilkytendercrispyweeknight

Ingredients

  • 4 cups water
  • 1 tbsp dashi powder or instant dashi
  • 2 tbsp soy sauce
  • 6 oz fresh ramen noodles
  • 2 heads bok choy, halved lengthwise
  • 2 whole eggs

Instructions

  1. 1

    Bring water to a boil in a large pot over high heat, then whisk in dashi powder and soy sauce.

  2. 2

    Add ramen noodles and bok choy. Simmer until noodles are tender and bok choy is just wilted, ~4 minutes.

  3. 3

    While noodles cook, heat 2 tbsp oil in a skillet over medium-high until shimmering.

  4. 4

    Crack eggs into the skillet. Fry until whites set but yolks jiggle, ~3 minutes.

  5. 5

    Ladle noodles and broth into bowls, then top each with a fried egg.

Tools you’ll need

  • large pot
  • whisk
  • 12-inch skillet
  • ladle
  • chopsticks or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.