Hawaiian Saimin with Egg & Bok Choy
Silky ramen noodles in a light dashi-inspired broth, topped with a crispy fried egg and tender bok choy. A 15-minute weeknight dinner that tastes like island comfort.
- Total time
- 15 min
- Servings
- 2
- Calories
- 385
- Protein
- 12g
comfortsimplehawaiianeggssilkytendercrispyweeknight
Ingredients
- 4 cups water
- 1 tbsp dashi powder or instant dashi
- 2 tbsp soy sauce
- 6 oz fresh ramen noodles
- 2 heads bok choy, halved lengthwise
- 2 whole eggs
Instructions
- 1
Bring water to a boil in a large pot over high heat, then whisk in dashi powder and soy sauce.
- 2
Add ramen noodles and bok choy. Simmer until noodles are tender and bok choy is just wilted, ~4 minutes.
- 3
While noodles cook, heat 2 tbsp oil in a skillet over medium-high until shimmering.
- 4
Crack eggs into the skillet. Fry until whites set but yolks jiggle, ~3 minutes.
- 5
Ladle noodles and broth into bowls, then top each with a fried egg.
Tools you’ll need
- large pot
- whisk
- 12-inch skillet
- ladle
- chopsticks or tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
