Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Hawaiian Fried Rice

Crispy fried rice loaded with ham, shrimp, pineapple, and eggs — sweet, savory, and ready in one skillet. A TikTok-easy dinner that tastes like vacation.

Total time
20 min
Servings
4
Calories
428
Protein
26g
20-Min Hawaiian Fried Rice
casualfreshhawaiianshrimphameggscrispytender

Ingredients

  • 3 cups cooked rice, chilled (day-old preferred)
  • 1 cup ham, diced small
  • ½ lb large shrimp, peeled and deveined
  • 1 cup pineapple chunks, fresh or canned (drained)
  • 3 whole eggs
  • 2 tbsp soy sauce
  • ½ cup scallions, chopped
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a large skillet over medium-high heat until it shimmers, ~60 seconds.

  2. 2

    Add shrimp and cook, stirring occasionally, until pink and cooked through, ~3 minutes.

  3. 3

    Push shrimp to the side. Crack eggs into the pan and scramble until just set, ~2 minutes.

  4. 4

    Add rice, breaking up clumps with the back of a spoon, and stir-fry for 2 minutes.

  5. 5

    Toss in ham, pineapple, soy sauce, and scallions. Stir everything together for 1 minute until hot.

  6. 6

    Serve immediately while steam is still rising.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.