Custrd is out on the App Store — Download it free →
Back to recipes

Hand Pie

A flaky, golden hand pie filled with a savory mixture of ground beef and onions, perfect for a quick snack or light meal.

Total time
30 min
Servings
4
Calories
450
Protein
18g
Hand Pie
comfortingAmericanbeefflakyflakyweeknightpiesnack

Ingredients

  • 1 sheet puff pastry
  • ½ lb ground beef
  • ½ medium onion
  • 1 large egg
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat oven to 400°F. In a skillet over medium heat, cook 0.5 lb ground beef and 0.5 diced onion until beef is browned and onion is soft, about 8 minutes. Season with 0.5 tsp salt and 0.25 tsp black pepper.

  2. 2

    Roll out 1 sheet puff pastry on a floured surface. Cut into 4 equal squares.

  3. 3

    Spoon the beef mixture onto one half of each square, leaving a border. Fold the other half over and press edges with a fork to seal.

  4. 4

    Beat 1 egg in a small bowl. Brush the tops of the pies with the beaten egg.

  5. 5

    Place pies on a baking sheet and bake until golden brown, about 15-20 minutes. Let cool slightly before serving.

Tools you’ll need

  • skillet
  • rolling pin
  • baking sheet
  • pastry brush
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.