Grilled Cheese
Crispy golden bread, melted cheese, and buttery edges—the ultimate comfort sandwich. Ready in 10 minutes with just four ingredients.
- Total time
- 10 min
- Servings
- 1
- Calories
- 380
- Protein
- 14g
comfortcasualamericanvegetariancrispymeltyweeknightlunch
Ingredients
- 2 slices bread (white, wheat, or sourdough)
- 2 slices cheese (cheddar, American, or gruyere)
- 1 tbsp butter, softened
- 0 salt and pepper to taste
Instructions
- 1
Butter one side of each bread slice generously.
- 2
Heat a skillet over medium heat until a drop of water sizzles on contact.
- 3
Place one slice butter-side down in the pan. Layer cheese on top.
- 4
Top with second slice, butter-side up. Cook until bottom is golden brown, ~3 minutes.
- 5
Flip carefully. Cook until second side is golden and cheese melts completely, ~2 minutes.
- 6
Remove to a plate. Season with salt and pepper if desired. Serve immediately.
Tools you’ll need
- 8-10 inch skillet or griddle
- spatula
- butter knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
