Garlic Butter Mozzarella Grilled Cheese
Crispy-edged bread stuffed with melty mozzarella and brushed with garlicky butter—no dairy-heavy sauces, just pure cheesy comfort. Ready in under 10 minutes.
- Total time
- 8 min
- Servings
- 2
- Calories
- 340
- Protein
- 12g
comfortsimpleamericanvegetariancheesecrispymeltyweeknight
Ingredients
- 4 slices bread
- 4 oz mozzarella cheese
- 2 tbsp butter
- ½ tsp garlic powder
Instructions
- 1
Mix softened butter with garlic powder until fragrant.
- 2
Spread garlic butter on one side of each bread slice.
- 3
Layer mozzarella between two slices, butter-side out on both sides.
- 4
Heat a skillet over medium-high until a drop of water sizzles immediately.
- 5
Sear sandwiches 2-3 minutes per side until golden brown and cheese melts.
- 6
Serve hot immediately.
Tools you’ll need
- 8-inch or 10-inch skillet
- butter knife or small spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
