Custrd is out on the App Store — Download it free →
Back to recipes

Greek Village Salad with Feta & Olives

Crisp tomatoes, cucumber, peppers, and creamy feta tossed with briny olives in a lemon-olive oil dressing. A bright, no-cook meal that tastes like a Greek island escape.

Total time
10 min
Servings
2
Calories
312
Protein
9g
Greek Village Salad with Feta & Olives
freshlightsimplegreekvegetariangluten-freecheesecrisp

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the cherry tomatoes and dice the cucumber and both peppers into 1/2-inch chunks.

  2. Step 2

    Add all diced vegetables, olives, and feta to a large bowl.

  3. Step 3

    Whisk together lemon juice, olive oil, salt, and pepper in a small bowl until combined.

  4. Step 4

    Pour the dressing over the salad and toss gently until all vegetables are coated.

  5. Step 5

    Let sit for 2 minutes so the flavors meld, then taste and adjust seasoning.

  6. Step 6

    Serve immediately or chill up to 1 hour before eating.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • small mixing bowl
  • whisk
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.