CookSnap is coming soon — Join the waitlist →
Back to recipes

Gratin de Cardons

Tender cardoons in a silky béchamel sauce, baked until golden and bubbling. A classic French vegetable gratin with Gruyère crust.

Total time
50 min
Servings
4
Calories
285
Protein
12g
Gratin de Cardons
comfortelegantfrenchvegetariancreamytendercrispyweeknight

Ingredients

  • 2 lbs cardoons, trimmed
  • 2 cups whole milk
  • 3 tbsp butter
  • 2 tbsp all-purpose flour
  • ¾ cup Gruyère cheese, grated
  • 1 serving salt and black pepper to taste
  • ¼ tsp nutmeg, freshly grated
  • 2 tbsp lemon juice
  • 2 tbsp olive oil

Instructions

  1. 1

    Trim cardoons: remove outer strings with a vegetable peeler, then cut into 2-inch pieces.

  2. 2

    Bring a large pot of salted water with lemon juice to a boil.

  3. 3

    Add cardoons and simmer until tender when pierced with a fork, 20–25 minutes.

  4. 4

    Drain cardoons well in a colander. Pat dry with paper towels.

  5. 5

    Heat butter in a medium saucepan over medium heat until foaming, ~1 minute.

  6. 6

    Whisk in flour to form a paste. Cook, stirring, until fragrant and light brown, 1 minute.

  7. 7

    Gradually whisk in milk, ensuring no lumps form. Simmer 2–3 minutes until slightly thickened.

  8. 8

    Remove from heat. Stir in 0.5 cup Gruyère, salt, pepper, and nutmeg until cheese melts.

  9. 9

    Heat oven to 400°F. Coat a 9-by-13-inch baking dish with olive oil.

  10. 10

    Spread drained cardoons in dish. Pour béchamel evenly over top.

  11. 11

    Sprinkle remaining 0.25 cup Gruyère over sauce. Bake until top is golden and edges bubble, 12–15 minutes.

  12. 12

    Let rest 3 minutes, then serve hot.

Tools you’ll need

  • vegetable peeler
  • large pot
  • colander
  • medium saucepan
  • whisk
  • 9-by-13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.