CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crispy Potato & Cheese Gratin

Thinly sliced potatoes layered with Gruyère and cream, baked until golden and bubbly. A French Alpine classic that tastes like you spent hours but takes just 20 minutes.

Total time
20 min
Servings
4
Calories
485
Protein
18g
20-Min Crispy Potato & Cheese Gratin
comfortcozyfrenchvegetariancheesecrispycreamytender

Ingredients

  • 1.5 lb potatoes (russet or waxy, peeled)
  • 1.5 cups Gruyère cheese, grated
  • 1 cup heavy cream
  • ½ cup whole milk
  • 2 count garlic cloves, minced
  • 1 tbsp butter (for greasing)

Instructions

  1. 1

    Preheat oven to 425°F. Butter an 8×10-inch baking dish generously.

  2. 2

    Slice potatoes 1/8-inch thick (use a mandoline if you have one). Pat dry with paper towels.

  3. 3

    Whisk cream, milk, garlic, salt, and pepper in a bowl until combined.

  4. 4

    Layer half the potatoes in the baking dish, overlapping slightly. Sprinkle half the cheese. Add remaining potatoes, then remaining cheese.

  5. 5

    Pour cream mixture over the top. Bake at 425°F until the surface turns golden and edges are bubbling, 16–18 minutes.

  6. 6

    Let rest 2 minutes. Serve hot with crusty bread or a simple salad.

Tools you’ll need

  • 8x10-inch baking dish
  • mandoline slicer (optional, or sharp knife)
  • whisk
  • measuring cups
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.