CookSnap is coming soon — Join the waitlist →
Back to recipes

Gochujang Pasta with Crispy Garlic

Spicy Korean red chile paste coats tender pasta with a silky, umami-rich sauce finished with crispy garlic oil. Ready in 20 minutes—no protein needed, but perfect alongside grilled chicken or tofu.

Total time
20 min
Servings
2
Calories
520
Protein
14g
Gochujang Pasta with Crispy Garlic
comfortquickkoreanvegetariansilkytenderweeknightpasta

Ingredients

  • 8 oz spaghetti or linguine
  • 3 tbsp gochujang (Korean red chile paste)
  • 4 cloves garlic, thinly sliced
  • 4 tbsp olive oil
  • 1 tbsp butter
  • 1 tbsp soy sauce
  • 2 tbsp sesame seeds (white or black, plus fresh scallion if desired)

Instructions

  1. 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~9 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    In a large skillet, heat olive oil over medium. Add sliced garlic and cook until golden and crispy, stirring occasionally, ~4 minutes.

  3. 3

    Reduce heat to medium-low. Stir in gochujang, breaking it up with a spoon until it coats the oil, ~1 minute.

  4. 4

    Add soy sauce and 0.5 cup pasta water. Stir until smooth. Add cooked pasta and toss to coat, adding more pasta water if needed.

  5. 5

    Remove from heat. Stir in butter until it melts and coats the pasta. Taste and adjust seasoning with salt if needed.

  6. 6

    Divide between bowls. Top with crispy garlic, sesame seeds, and fresh scallion if using. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet (12-inch preferred)
  • wooden spoon
  • tongs or pasta fork
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.