CookSnap is coming soon — Join the waitlist →
Back to recipes

Chili Crisp Gochujang Pasta

Spicy, garlicky pasta coated in gochujang-butter sauce with a hit of chili crisp. Ready in 15 minutes — the weeknight dinner that tastes like you tried.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Chili Crisp Gochujang Pasta
quicksatisfyingkoreanvegetarianvegetariancreamytenderweeknight

Ingredients

  • 8 oz spaghetti or linguine
  • 3 tbsp gochujang (Korean red chili paste)
  • 3 tbsp butter
  • 2 tbsp chili crisp (Calabrian, Lao Gan Ma, or similar)
  • ½ cup Parmesan cheese, grated
  • 1 whole lemon (zested + juiced)

Instructions

  1. 1

    Boil salted water in a large skillet over high heat. Add pasta and cook until al dente, ~9 minutes.

  2. 2

    Reserve 1 cup pasta water, then drain pasta. Return it to the skillet off heat.

  3. 3

    Add gochujang, butter, and chili crisp to the pasta. Toss over medium heat until the sauce coats every strand, ~2 minutes.

  4. 4

    Add half the reserved pasta water and stir until glossy and creamy. Add more if needed.

  5. 5

    Fold in lemon zest and juice. Taste and adjust salt, then divide between bowls.

  6. 6

    Top each bowl with Parmesan and a drizzle of chili crisp. Serve immediately.

Tools you’ll need

  • large skillet (12-inch minimum)
  • wooden spoon or pasta tongs
  • measuring cups and spoons
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.