CookSnap is coming soon — Join the waitlist →

20-Minute Veggie Bibimbap Bowl

A vibrant Korean rice bowl loaded with sautéed vegetables, a runny fried egg, and a punchy gochujang-sesame sauce that brings everything together. No stone bowl required—one skillet, one rice cooker, five minutes of vegetable work.

Total time
20 min
Servings
2
Calories
420
Protein
12g
20-Minute Veggie Bibimbap Bowl
quicksatisfyingkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked short-grain rice (day-old or warm)
  • 2 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 3 cups mixed fresh vegetables (spinach, shredded carrot, sliced zucchini, mushrooms, bean sprouts)
  • 2 whole eggs
  • 1 tbsp soy sauce

Instructions

  1. 1

    Stir gochujang, 1 tbsp sesame oil, soy sauce, and 2 tbsp water in a small bowl until smooth.

  2. 2

    Heat 1 tbsp sesame oil in a large skillet over medium-high heat until shimmering.

  3. 3

    Add vegetables in batches, starting with firmer ones (carrot, zucchini), sautéing 2 minutes, then spinach and softer items.

  4. 4

    Push vegetables to the sides of the skillet and crack eggs into the center. Cook until whites set, 3-4 minutes.

  5. 5

    Divide rice between two bowls and top with sautéed vegetables and a fried egg.

  6. 6

    Drizzle gochujang sauce over the bowl and mix vigorously before eating.

Tools you’ll need

  • 12-inch skillet or larger
  • small bowl
  • wooden spoon or spatula
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.