CookSnap is coming soon — Join the waitlist →
Back to recipes

Gochujang Pasta with Charred Broccoli

Korean chili heat meets Italian pasta in this one-pan dinner. Gochujang, garlic, and sesame oil coat tender noodles and crispy broccoli for a quick, craveable meal.

Total time
25 min
Servings
2
Calories
410
Protein
12g
Gochujang Pasta with Charred Broccoli
comfortquickkoreanitalianvegetariancrispytenderweeknight

Ingredients

  • 8 oz spaghetti or linguine
  • 3 cups broccoli, cut into bite-sized florets
  • 3 tbsp gochujang (Korean red chili paste)
  • 3 cloves garlic, minced
  • 2 tbsp sesame oil
  • 2 tbsp olive oil
  • 1 to taste salt and pepper to taste

Instructions

  1. 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, heat olive oil in a large skillet over medium-high heat.

  3. 3

    Add broccoli florets. Cook, stirring occasionally, until charred and fork-tender, ~6 minutes.

  4. 4

    Push broccoli to the side. Add garlic to the empty space and cook until fragrant, ~30 seconds.

  5. 5

    Add gochujang and sesame oil. Stir constantly until the paste breaks down and coats the broccoli, ~1 minute.

  6. 6

    Drain pasta, reserving 1/2 cup cooking water. Add pasta to the skillet.

  7. 7

    Toss pasta and broccoli together, adding cooking water a splash at a time until sauce coats everything.

  8. 8

    Season with salt and pepper. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • colander
  • tongs or large spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.