CookSnap is coming soon — Join the waitlist →
Back to recipes

Ginger Fish Stir-Fry with Noodles & Veg

Tender flaked fish tossed with fresh ginger, soy, and lime over egg noodles with steamed broccoli, cauliflower, and tomatoes. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
38g
Ginger Fish Stir-Fry with Noodles & Veg
lightfreshthaifishtendercrispyweeknightstir-fry

Ingredients

  • 1 lb firm white fish fillets (cod, halibut, or mahi)
  • 2 tbsp fresh ginger, minced
  • 3 tbsp soy sauce
  • 1 whole lime (juiced)
  • ½ tsp red chili flakes or fresh Thai chili, sliced
  • 6 oz egg noodles
  • 2 cups broccoli florets
  • 1 cup cherry tomatoes, halved

Instructions

  1. 1

    Boil egg noodles in salted water until al dente, about 5–6 minutes. Drain and set aside.

  2. 2

    While noodles cook, steam broccoli and cauliflower in a separate pot or steamer basket, 5 minutes, until just tender.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers. Pat fish dry and season with salt and pepper.

  4. 4

    Sear fish 3 minutes per side without moving, until opaque and flaking at edges. Break into bite-sized pieces.

  5. 5

    Add minced ginger and chili to the skillet, stir 30 seconds until fragrant. Pour in soy sauce and lime juice.

  6. 6

    Toss in cooked noodles, steamed broccoli, cauliflower, and cherry tomatoes. Stir until warm, about 1 minute.

  7. 7

    Divide between bowls. Serve with lime wedges on the side.

Tools you’ll need

  • large skillet or wok
  • pot for boiling noodles
  • steamer basket or pot with lid
  • tongs
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.