CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Catfish Salad with Thai Chili Dressing

Catfish fillets pan-fried until golden and crispy, served over cool greens with a punchy Thai chili-lime dressing. Ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
285
Protein
28g
Crispy Catfish Salad with Thai Chili Dressing
freshlightthaifishcrispytenderweeknightsalad

Ingredients

  • ¾ lb catfish fillets
  • 3 cups mixed salad greens
  • ½ whole cucumber
  • 1 whole lime
  • 1 tbsp Thai chili paste
  • 1 tbsp fish sauce

Instructions

  1. 1

    Pat catfish fillets dry with paper towels. Season both sides with salt and pepper.

  2. 2

    Slice cucumber into thin rounds. Juice the lime into a small bowl.

  3. 3

    Whisk lime juice, chili paste, and fish sauce until smooth. Set dressing aside.

  4. 4

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers.

  5. 5

    Slide catfish into the pan. Sear 3-4 minutes per side without moving until edges are deep golden.

  6. 6

    Transfer cooked catfish to a cutting board and break into bite-size pieces.

  7. 7

    Toss greens and cucumber with dressing. Divide between bowls.

  8. 8

    Top each bowl with warm catfish. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • small bowl
  • whisk
  • cutting board
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.