CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Garlic Parmesan Fries

Frozen fries crisped in the oven, then tossed with melted garlic butter and a shower of sharp Parmesan and fresh parsley. Ready in 20 minutes—the perfect salty, savory side that doubles as dinner.

Total time
20 min
Servings
2
Calories
380
Protein
11g
Crispy Garlic Parmesan Fries
comfortquickamericanvegetariancrispyweeknightsidedinner

Ingredients

  • 1 lb frozen french fries
  • 3 cloves garlic, minced
  • ½ cup parmesan cheese, grated
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Spread frozen fries on a sheet pan and bake at 400°F until golden and crispy, 18–20 minutes.

  2. 2

    While fries bake, warm oil in a small skillet over medium and cook minced garlic until fragrant, about 1 minute.

  3. 3

    Transfer hot fries to a large bowl and pour the warm garlic oil over them.

  4. 4

    Toss fries until evenly coated, then sprinkle Parmesan and parsley over the top.

  5. 5

    Toss again gently and serve immediately while fries are still hot and crispy.

Tools you’ll need

  • sheet pan
  • oven
  • small skillet
  • large bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.