CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlic Ginger Stir Fry Noodles

A fast, vegetable-forward noodle stir-fry with a bright garlic-ginger sauce. Ready in 20 minutes with ingredients you likely have on hand.

Total time
20 min
Servings
2
Calories
385
Protein
10g
Garlic Ginger Stir Fry Noodles
quickcasualasianveganchewycrispyweeknightnoodles

Ingredients

  • 6 oz noodles (ramen, spaghetti, or lo mein)
  • 2 cups mixed vegetables (bell peppers, broccoli, snap peas, carrots)
  • 3 cloves garlic, minced
  • 1 tbsp fresh ginger, minced
  • 3 tbsp soy sauce
  • 1 tbsp sesame oil
  • 2 tbsp vegetable oil

Instructions

  1. 1

    Boil salted water in a pot. Add noodles and cook until al dente, ~4 minutes. Drain and set aside.

  2. 2

    Cut vegetables into bite-sized pieces (peppers into strips, broccoli into florets, snap peas halved lengthwise).

  3. 3

    Heat vegetable oil in a large skillet or wok over high heat until it shimmers, ~90 seconds.

  4. 4

    Add garlic and ginger. Stir constantly until fragrant, about 30 seconds.

  5. 5

    Add vegetables. Cook, stirring often, until tender-crisp, ~4 minutes.

  6. 6

    Add cooked noodles, soy sauce, and sesame oil. Toss until everything is coated and heated through, ~90 seconds.

  7. 7

    Serve hot from the pan.

Tools you’ll need

  • large pot
  • 12-inch skillet or wok
  • wooden spoon or cooking chopsticks
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.