CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Noodle Stir-Fry with Vegetables

A vibrant stir-fry loaded with crispy noodles, tender vegetables, and a savory-sweet sauce that coats every bite. Ready in under 25 minutes with pantry staples and whatever vegetables you have on hand.

Total time
25 min
Servings
4
Calories
285
Protein
8g
Crispy Noodle Stir-Fry with Vegetables
quicksatisfyingasianvegancrispytenderweeknightstir-fry

Ingredients

  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 tbsp honey or brown sugar
  • ½ tbsp sesame oil
  • 2 cloves garlic, minced
  • 1 tbsp ginger, minced
  • 8 oz ramen or chow mein noodles
  • 4 cups mixed vegetables (bell pepper, snap peas, carrots, broccoli)
  • 3 stalks scallions, cut into 1-inch pieces
  • 2 tbsp vegetable oil
  • ¼ tsp red pepper flakes (optional)

Instructions

  1. 1

    Boil salted water in a large pot. Add noodles and cook until just tender, ~3 minutes. Drain and set aside.

  2. 2

    Whisk soy sauce, rice vinegar, honey, sesame oil, minced garlic, and ginger in a small bowl. Set aside.

  3. 3

    Cut bell peppers, snap peas, and carrots into bite-sized pieces. Chop broccoli into small florets.

  4. 4

    Heat oil in a large skillet or wok over medium-high heat until shimmering, ~60 seconds.

  5. 5

    Add cooked noodles in a single layer. Let sit undisturbed for 90 seconds until the bottom starts to crisp and char.

  6. 6

    Stir noodles and break apart clumps. Spread into a single layer again and crisp for another 60 seconds until the top edges curl.

  7. 7

    Push noodles to the side. Add vegetables to the empty space and stir-fry for 3 minutes until tender-crisp.

  8. 8

    Add the sauce to the pan. Toss everything together for 60 seconds until the noodles and vegetables are evenly coated and glossy.

  9. 9

    Remove from heat. Stir in scallions and red pepper flakes if using. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet or wok (12-inch minimum)
  • small mixing bowl
  • whisk
  • cutting board and knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.