CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlic Butter Shrimp Noodles

Tender shrimp tossed with fresh pasta in a punchy garlic-butter sauce spiked with white wine and lemon. Bay Area classic, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Garlic Butter Shrimp Noodles
freshsimplecalifornianshrimptendersilkyweeknightpasta

Ingredients

  • 8 oz fresh linguine or fettuccine
  • ¾ lb large shrimp, peeled and deveined
  • 5 cloves garlic, minced
  • ⅓ cup dry white wine
  • 3 tbsp butter
  • 1 whole lemon (juiced)
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Boil salted water in a large skillet over high heat. Add pasta and cook until al dente, ~3 minutes. Reserve 1/2 cup pasta water before draining.

  2. 2

    Return skillet to medium-high heat. Add butter and garlic, stirring constantly until fragrant, about 30 seconds.

  3. 3

    Add shrimp and red pepper flakes. Sear without stirring for 60 seconds, then toss and cook until shrimp turn pink, ~90 seconds more.

  4. 4

    Pour in white wine, scraping any stuck bits from the pan. Simmer for 90 seconds until reduced by half.

  5. 5

    Return pasta to skillet with lemon juice and 1/4 cup reserved pasta water. Toss to coat, adding more pasta water if needed for a glossy finish.

  6. 6

    Taste and season with salt and pepper. Serve immediately with extra lemon wedges.

Tools you’ll need

  • large skillet (12-inch minimum)
  • pasta fork or tongs
  • wooden spoon
  • microplane zester or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.