CookSnap is coming soon — Join the waitlist →

Garlic & Oil Pasta

Silky spaghetti coated in toasted garlic and olive oil—a classic Roman dish that's faster than takeout. Finish with red pepper flakes and fresh parsley for brightness.

Total time
15 min
Servings
2
Calories
520
Protein
17g
Garlic & Oil Pasta
simplefreshitalianvegetarianvegansilkytenderweeknight

Ingredients

  • 8 oz spaghetti
  • 4 garlic cloves, thinly sliced
  • ¼ cup olive oil
  • ¼ tsp red pepper flakes
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Boil salted water in a large pot. Add spaghetti and cook until al dente, per package directions.

  2. 2

    While pasta cooks, heat olive oil in a skillet over medium. Add garlic slices.

  3. 3

    Cook garlic, stirring often, until golden and fragrant, 3–4 minutes. Do not brown.

  4. 4

    Add red pepper flakes to the skillet. Stir for 10 seconds.

  5. 5

    Drain pasta, reserving 1 cup pasta water. Add pasta to the skillet with garlic oil.

  6. 6

    Toss over medium heat, adding pasta water 2 tbsp at a time until silky, 1–2 minutes.

  7. 7

    Divide into bowls. Top with parsley and a pinch of salt. Serve immediately.

Tools you’ll need

  • large pot
  • wooden spoon or pasta fork
  • 12-inch skillet
  • measuring spoons
  • colander
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.