CookSnap is coming soon — Join the waitlist →
Back to recipes

Green Pasta with Crispy Shrimp

Peruvian tallarines verdes—vibrant basil-spinach pasta tossed with pan-seared shrimp in a garlicky cream finish. Ready in under 20 minutes for a weeknight dinner that feels restaurant-quality.

Total time
18 min
Servings
2
Calories
628
Protein
38g
Green Pasta with Crispy Shrimp
satisfyingelegantperuvianshrimpcreamytendercrispyweeknight

Ingredients

  • 1.5 cups fresh basil
  • 1 cup fresh spinach
  • ½ cup heavy cream
  • 1 whole (juiced) lime
  • 8 oz spaghetti or fettuccine
  • ¾ lb shrimp, peeled & deveined
  • 3 cloves (minced) garlic

Instructions

  1. 1

    Bring a large pot of salted water to boil. Add pasta and cook until al dente, ~9 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    While pasta cooks, blend basil, spinach, cream, lime juice, and a pinch of salt until smooth. Set the sauce aside.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  4. 4

    Add shrimp and cook without stirring until edges curl and undersides turn pink, ~2 minutes. Flip and cook another 90 seconds until cooked through.

  5. 5

    Add minced garlic to the skillet and stir for 30 seconds until fragrant.

  6. 6

    Return pasta to the skillet, pour in basil-cream sauce, and toss gently. Add pasta water 1/4 cup at a time until the sauce coats the noodles. Serve immediately.

Tools you’ll need

  • large pot
  • colander
  • blender or food processor
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.