CookSnap is coming soon — Join the waitlist →
Back to recipes

Frozen Chocolate Banana Pops

Creamy frozen banana dipped in melted chocolate and hardened in minutes. A no-bake snack that tastes like ice cream on a stick.

Total time
10 min
Servings
4
Calories
185
Protein
2g
Frozen Chocolate Banana Pops
simplequickvegetariancreamycrispysnacksummerfrozen

Ingredients

  • 2 whole banana
  • ¾ cup chocolate chips or chopped chocolate
  • 1 tbsp coconut oil or butter
  • 2 tbsp toppings (optional: sprinkles, chopped nuts, or cocoa powder)

Instructions

  1. 1

    Cut bananas in half crosswise. Insert a popsicle stick or skewer into each flat end.

  2. 2

    Arrange banana pops on a parchment-lined baking sheet. Freeze for 5 minutes.

  3. 3

    Combine chocolate and coconut oil in a small microwave-safe bowl. Microwave in 20-second bursts, stirring between, until smooth.

  4. 4

    Working quickly, dip each frozen banana into warm chocolate, coating all sides. Let excess drip off.

  5. 5

    If using toppings, sprinkle them onto chocolate before it sets. Return to freezer.

  6. 6

    Freeze until chocolate hardens, 2–3 minutes. Serve immediately or store in freezer for up to 2 days.

Tools you’ll need

  • popsicle sticks or wooden skewers
  • baking sheet
  • parchment paper
  • small microwave-safe bowl
  • spoon or fork for dipping

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.