CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Fish Amritsari

Crispy-coated fish from Punjab's sacred city, fried until golden and served with a squeeze of lemon. A street-food favorite that delivers big flavor in under 30 minutes.

Total time
25 min
Servings
2
Calories
280
Protein
28g
Fish Amritsari
casualsatisfyingindianfishcrispytenderweeknightappetizer

Ingredients

  • ¾ lb fish fillets (cod, halibut, or any firm white fish)
  • ½ cup all-purpose flour
  • ¼ cup cornstarch
  • 1 tbsp ginger-garlic paste
  • ½ tsp red chili powder
  • vegetable oil for frying

Instructions

  1. 1

    Pat the fish fillets dry using a clean paper towel or kitchen cloth, pressing gently on both sides to remove surface moisture so the coating will stick properly.

  2. 2

    In a small bowl, combine the ginger-garlic paste, red chili powder, 0.5 teaspoon salt, and 1/4 teaspoon black pepper with 2 tablespoons water, stirring until the spices form a thin, spreadable paste.

  3. 3

    Rub the spice paste evenly over both sides of each fish fillet, using your fingers to coat the entire surface; let rest on a plate for 5 minutes so flavors begin to penetrate the fish.

  4. 4

    Pour the flour and cornstarch into a shallow bowl or plate, add 0.25 teaspoon salt and 0.25 teaspoon black pepper, and stir with a fork until evenly mixed.

  5. 5

    Working with one fillet at a time, lay it in the flour mixture and press gently, then flip and press the other side, turning to coat every edge in a thin, even layer; shake off excess flour back into the bowl.

  6. 6

    Pour vegetable oil into a 10-inch skillet to a depth of 0.75 inch and heat over medium-high heat until a small piece of bread dropped into the oil sizzles immediately and rises to the surface, about 2 minutes.

  7. 7

    Carefully lay both coated fish fillets into the hot oil; listen for an immediate, steady sizzle. Do not move them for 3 minutes so the underside becomes golden brown.

  8. 8

    Using a thin metal spatula, carefully slide underneath each fillet and flip it over in one smooth motion, then fry the second side for 2 to 3 minutes until it also turns golden brown and the flesh looks opaque when you peek at the thickest part.

  9. 9

    Transfer the fried fish to a paper-towel-lined plate to drain excess oil for 1 minute, then slide onto a serving plate.

  10. 10

    Squeeze fresh lemon juice over the top of each fillet just before serving, and sprinkle with a pinch of chaat masala or red chili powder if desired.

Tools you’ll need

  • paper towels
  • small bowl
  • fork
  • shallow plate or bowl
  • 10-inch skillet
  • thermometer (optional, to verify oil temperature)
  • thin metal spatula
  • plate lined with paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.